PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009629525.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 390aa    MW: 44437.1 Da    PI: 7.2206
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009629525.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.1e-52141411128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     + pGfrFhPtdeelv +yL++kv++k++++ e ik++diyk++PwdLpk ++ +ekewyf+++rd+ky+++ r+nr+t +g+Wkatg+d++++s+
  XP_009629525.1  14 MLPGFRFHPTDEELVGFYLRRKVQQKPISI-ELIKQLDIYKYDPWDLPKLATVGEKEWYFYCPRDRKYRNSARPNRVTGAGFWKATGTDRPIYSS 107
                     579***************************.89***************8778899***************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++ +glkk+Lvfykgra kg ktdW+mhe+rl
  XP_009629525.1 108 eGSKCIGLKKSLVFYKGRAAKGIKTDWMMHEFRL 141
                     56677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-5712172IPR003441NAC domain
PROSITE profilePS5100557.26214172IPR003441NAC domain
PfamPF023651.2E-2516141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0045770Biological Processpositive regulation of asymmetric cell division
GO:0048103Biological Processsomatic stem cell division
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MEERNEKEKM DEVMLPGFRF HPTDEELVGF YLRRKVQQKP ISIELIKQLD IYKYDPWDLP  60
KLATVGEKEW YFYCPRDRKY RNSARPNRVT GAGFWKATGT DRPIYSSEGS KCIGLKKSLV  120
FYKGRAAKGI KTDWMMHEFR LPSITDSTAP KRFLDKHIPP NDSWAICRIF KKANSNTHRS  180
LSHSWVSPTV PENTTSDFLT SSHFTNYSNE ISLINKTSSP IQFSGCSIND LQNSSSNMTS  240
FSTLDLPLYK SLNSNYDPIT SYTFSSCTET SEILPLPKCI NMSNNNIDAS SLLLNMSSSI  300
FGDYSIPLPE NIEGGGVHDQ ETTLKEANHV NNMDHMEEQW RNVRSIGLLP LNNFPLNMAA  360
DAWKTNLLWD SSPCPSSEIA TSYSTNKCYT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-541617519168NO APICAL MERISTEM PROTEIN
1ut4_B2e-541617519168NO APICAL MERISTEM PROTEIN
1ut7_A2e-541617519168NO APICAL MERISTEM PROTEIN
1ut7_B2e-541617519168NO APICAL MERISTEM PROTEIN
4dul_A2e-541617519168NAC domain-containing protein 19
4dul_B2e-541617519168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1492881e-109AC149288.1 Solanum demissum chromosome 5 clone PGEC446J10, complete sequence.
GenBankEF5142121e-109EF514212.1 Solanum tuberosum strain P6/210 contig R1, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009629525.10.0PREDICTED: putative NAC domain-containing protein 94 isoform X2
SwissprotQ9ZVH01e-111FEZ_ARATH; Protein FEZ
TrEMBLM1D3A90.0M1D3A9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000803070.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-112NAC family protein